PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G58890.1
Common NameAGL82
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 294aa    MW: 34165.9 Da    PI: 9.274
Description AGAMOUS-like 82
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G58890.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.75.3e-171051243
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 ri n+  r +t+ kR++ + KKA+E S+LC++e ++i++++t
  AT5G58890.1 10 RIANDKTRITTYKKRKASLYKKAQEFSTLCGVETCLIVYGPT 51
                 89**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-12160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.858151IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-7323IPR002100Transcription factor, MADS-box
CDDcd002663.01E-25381No hitNo description
SuperFamilySSF554553.27E-17686IPR002100Transcription factor, MADS-box
PfamPF003193.3E-161052IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020090anatomyembryo sac central cell
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MVPKVVDLQR IANDKTRITT YKKRKASLYK KAQEFSTLCG VETCLIVYGP TKATDVVISE  60
PEIWPKDETK VRAIIRKYKD TVSTSCRKET NVETFVNDVG KGNEVVTKKR VKRENKYSSW  120
EEKLDKCSRE QLHGIFCAVD SKLNEAVTRQ ERSMFRVNHQ AMDTPFPQNL MDQQFMPQYF  180
HEQPQFQGFP NNFNNMGFSL ISPHDGQIQM DPNLMEKWTD LALTQSLMMS KGNDGTQFMQ  240
RQEQPYYNRE QVVSRSAGFN VNPFMGYQVP FNIPNWRLSG NQVENWELSG KKTI
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184241680.0
Genevisible247767_at0.0
Expression AtlasAT5G58890-
AtGenExpressAT5G58890-
ATTED-IIAT5G58890-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G58890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G31630, AT1G46408, AT1G47760, AT1G48150, AT1G77980
IntActSearch Q9FIM0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G58890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0168850.0AB016885.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K19M22.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200697.10.0protein AGAMOUS-LIKE 82
SwissprotQ9FIM00.0AGL82_ARATH; Agamous-like MADS-box protein AGL82
TrEMBLD7MR430.0D7MR43_ARALL; MADS-box family protein
STRINGAT5G58890.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59481947
Representative plantOGRP3677621
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  8. Yang TJ,Perry PJ,Ciani S,Pandian S,Schmidt W
    Manganese deficiency alters the patterning and development of root hairs in Arabidopsis.
    J. Exp. Bot., 2008. 59(12): p. 3453-64
    [PMID:18772308]
  9. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  10. Li HJ, et al.
    Arabidopsis CBP1 Is a Novel Regulator of Transcription Initiation in Central Cell-Mediated Pollen Tube Guidance.
    Plant Cell, 2015. 27(10): p. 2880-93
    [PMID:26462908]